Guntur
City
Guntur district
Andhra Pradesh
743,354 in 2011
ULB TYPE: Municipal Corporation (Guntur Municipal Corporation, est. 1866 per the Guntur district Wikipedia page; upgraded to corporation 1994 per List of municipalities in Andhra Pradesh). City population 743,354; metropolitan/urban agglomeration 1,028,667 (2011). District headquarters. Serves as headquarters of both Guntur East and Guntur West mandals.
Community institutions
Kanyaka Parameswari Temple, Brodipet, Guntur
Temple ·
low confidence
Second Kanyaka Parameswari temple in Guntur, sited in the Brodipet commercial grid - i.e. in the merchant quarter.
Sri Vasavi Kanyaka Parameswari Devi Devasthanam, R Agraharam, Guntur
Temple ·
low confidence
Arya Vysya devasthanam on Etukuru Road, R Agraharam. Secondary accounts describe it as over 100 years old with a temple board running annadanam and community welfare, but the temple's own domain (srikanyakaparameshwaritemple.com) did not resolve when fetched, so those claims could NOT be verified at source. The map listing confirms only the temple's existence and location.
Families who recorded this place
No family has recorded this place yet.
Add your family and name your village or town.