Guntur
Town
Guntur district
Andhra Pradesh
Carried in because a Vasavi Club is recorded here in the 2014 register.
Community institutions
Guntur
Club ·
high confidence
Listed in Vasavi Clubs International's own club-wise KCGF table, archived 22 June 2014 - evidence the club existed then, not a current roster. District and state are inferred from the town name, not stated by the source.
Guntur Greater
Club ·
high confidence
Listed in Vasavi Clubs International's own club-wise KCGF table, archived 22 June 2014 - evidence the club existed then, not a current roster. District and state are inferred from the town name, not stated by the source.
Vanitha Guntur
Club ·
high confidence
Listed in Vasavi Clubs International's own club-wise KCGF table, archived 22 June 2014 - evidence the club existed then, not a current roster. District and state are inferred from the town name, not stated by the source.
Sri Rukmini Satyabhama sameta Kaliyamardana Swamy Devasthanam, Guntur
Satram ·
medium confidence
Register entry 'శ్రీ రుక్మిణీ సత్యభామ సహిత కాళీయమర్దనస్వామి వారి దేవస్థానము, కోనేరు రోడ్, గుంటూరు'. Appears in the Arya Vysya nitya-anna satram register as an annadanam venue; the temple itself is a Krishna temple, so its Vysya link rests on the register alone. Recorded from the community-maintained Arya Vysya nitya-anna satram register; the same register also appears, machine-translated into English, on aryavysyasangam.com, so the two are not independent sources. Contact phone numbers published alongside each entry have been deliberately omitted.
Kanyaka Parameswari Temple, Brodipet, Guntur
Temple ·
low confidence
Second Kanyaka Parameswari temple in Guntur, sited in the Brodipet commercial grid - i.e. in the merchant quarter.
Sri Vasavi Kanyaka Parameswari Devi Devasthanam, R Agraharam, Guntur
Temple ·
low confidence
Arya Vysya devasthanam on Etukuru Road, R Agraharam. Secondary accounts describe it as over 100 years old with a temple board running annadanam and community welfare, but the temple's own domain (srikanyakaparameshwaritemple.com) did not resolve when fetched, so those claims could NOT be verified at source. The map listing confirms only the temple's existence and location.
Families who recorded this place
No family has recorded this place yet.
Add your family and name your village or town.
Source
Vasavi Clubs International - KCGF Donors, club-wise list (vasaviclubs.org, archived 22 June 2014)
low confidence
Elsewhere in Guntur
113 ThalluruAbbarajupalemAgatha VarappaduAinavoluAminabadaAnanthavaramAnanthavarappaduAndhra Paris TenaliAngalakuduruAnkireddipalem (R)AnnaparruAnnavaramAnnavaramAnumarlapudiAppapuramAremandaAthotaAtmakur (Og)BandarupalleBejatpuramBethapudiBhallukanudupalemBodipalemBommuvaripalemBorupalemBrahmanakodurBudampaduBurripalemChamallamudiChebroluChemudupaduChiluvuruChina PalakaluruChina Ravuru (R)ChinakakaniChinapalemChinavadlapudiChintalapudiChintalapudiChirravuru