Vasavi Kanyaka Parameswari temples
Every temple, satram, sangam and trust recorded in Andhra Pradesh and Telangana that carries her name. This is the community's own map — where it built, endowed and fed. Each entry links to the source that documents it.
222 institutions
168 places
55 districts
33 high confidence
10 with a photograph
About the pictures. A photograph appears only where a freely licensed one
exists for that exact building, with its licence and author recorded. Most of these
temples have none, so most cards show no photograph. Filling those gaps with stock
images or generated artwork would leave you believing you had seen a temple you had
not — the image on this page is devotional artwork made for this site, and is
not any of these murtis.
Is your town's temple missing?
This register was built from gazetteers, inscriptions and published sources, so it is strongest where somebody once wrote things down — and weakest exactly where the community lives now. If the temple in your town, mandal or district is not here, add it. You do not need an account.
Add a templeHave a photograph of one of these?
Only 10 of 222 have one. That is not for want of looking — the whole of Wikimedia Commons holds about twenty freely licensed photographs of Vasavi Kanyaka Parameswari buildings, because no photography project has ever covered small living community temples and satrams. The gap closes when families and sangams contribute their own.
A photograph can be published here if whoever took it releases it under a licence that permits reuse — CC BY or CC BY-SA are the usual choices, and the photographer keeps the credit. The simplest route is to upload it to Wikimedia Commons naming the temple and its town, which makes it available to every Telugu Wikipedia article as well as to this register. If you would rather send them directly, a family administrator can add them through the family that maintains the temple.
Andhra Pradesh · 141
Sri Kanyaka Parameswari shrine, Anakapalli
Anakapalli,
Anakapalli
The official Visakhapatnam district portal names 'the shrine of Kanyaka Parameswari' at Anakapalli, alongside Nookalamma, as famous and drawing large numbers of devotees. Kanyaka Parameswari is the Arya Vysya kuladevata.
Photo:
Titanium97 (Wikimedia Commons user)
· CC BY-SA 3.0
No freely licensed photograph
of this building yet
of this building yet
Kanyaka Parameswari temple built by the Komatis of Gooty
Gooty,
Anantapur
1905 Madras District Gazetteer, Ch. XV, p. 154, verbatim: 'There are no temples of architectural merit in Gooty... The Komatis have built a new temple to their patron goddess Kanyaka Paramesvari. The mass of the people pay their c…
No freely licensed photograph
of this building yet
of this building yet
Kanyakamma (Kanyaka Parameswari) temple built by the local Komatis, in a bazaar street of Tadipatri
Tadipatri,
Anantapur
1905 Madras District Gazetteer, Ch. XV, p. 202, verbatim: 'In one of the bazaar streets is a noteworthy construction. It is a temple which is being erected by the local Komatis to their caste goddess Kanyakamma, the deified form o…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Devalayam and satram, Kanduru
Kanduru,
Annamayya
The article states plainly: 'in this village there is a Sri Vasavi Kanyaka Parameswari temple and a satram (సత్రము)'. The village lies 12 km from Somala and 23 km from Madanapalle. Notable as a paired temple + choultry in a small …
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyakaparameswari Ammavari Devalayam, Eepurupalem
Eepurupalem,
Bapatla
Named first among the village's temples, 'on the road going to the railway station'. Telugu Wikipedia also carries a photograph of it (file 'శ్రీ వాసవి కన్యకాపరమేశ్వరి అమ్మవారి దేవాలయము, ఈపూరుపాలెం.jpg'). The article files the vil…
No freely licensed photograph
of this building yet
of this building yet
Sri Balakoteswaraswamy - Kanyaka Parameswari Arya Vysya Annadana Satram, Govada
Govada,
Bapatla
Has its own section ('ఆర్యవైశ్య అన్నదాన సత్రం') in the article on the Sri Balakoteswaraswamy temple at Govada: the satram 'has been serving since 1965. On Mahasivaratri day annadanam is conducted for several thousand devotees. Ann…
No freely licensed photograph
of this building yet
of this building yet
Sri Kanyakaparameswari Ammavari Alayam, Nizampatnam
Nizampatnam,
Bapatla
Own section: 'This temple has been newly built in Santa Bazaar in the village.' Nizampatnam is an ancient port and mandal headquarters.
No freely licensed photograph
of this building yet
of this building yet
Kanyaka Parameswari Devalayam, Ravinuthala
Ravinuthala,
Bapatla
Mentioned twice: in the temple list as 'the Kanyaka Parameswari temple in Boddu Rayi street', and separately - 'Sri Kanyaka Parameswari Ammavari gudi: in this temple the Vysya Sangham conducts the Navaratris. Celebrating Arudrotsa…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Kanyakaparameswari Shaktipeetham, Mukkamala
Mukkamala,
East Godavari
Own section: 'Here is the Kanyakaparameswari Shaktipeetham established by a swami of Marteru.' (The founder is named in the source; the name is withheld here.) Independently corroborated by the Arya Vysya nitya-anna-satram registe…
No freely licensed photograph
of this building yet
of this building yet
Janardana Kanyakaparameswari Devi Gudi, Eluru
Eluru,
Eluru
Named in the Eluru article's list of temples 'with a history of more than a thousand years', alongside the Ramalingeswaraswamy, Jwalapahareswaraswamy, Kasiviswaswaraswamy, Markandeya and Omkareswaraswamy temples. The compound name…
No freely licensed photograph
of this building yet
of this building yet
Sri Kanyaka Parameswari Devalayam (Vasavi Kanyaka Parameswari kshetram), Kaikaluru
Kaikaluru,
Eluru
Heads the list of 'places to see / temples' in Kaikaluru. Telugu Wikipedia also carries a photograph captioned 'కైకలూరు వాసవి కన్యకా పరమేశ్వరి క్షేత్రం'. The article files Kaikaluru under Krishna district; the mandal is now in Elu…
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Kalyana Mandapam, Chundur (Tsunduru)
Chundur (Tsunduru),
Guntur
'In this village an Arya Vysya kalyana mandapam built with Rs. 60 lakh of donations was inaugurated on 14 December 2014.'
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Ammavari Alayam, Namburu
Namburu,
Guntur
Own section: 'As part of the idol-installation celebrations at this temple, special poojas were held on Tuesday 6 June 2017; homams and abhishekams on the 7th; and on the morning of Thursday the 8th the installation of a new dhwaj…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Sangham, Rudravaram (trustees of the Sri Kodandaramaswamy temple)
Rudravaram,
Nandyal
The village's Sri Kodandaramaswamy temple 'was built in 1914, and from then onwards the Arya Vysya Sangham of the village has conducted the annual festival'. Centenary celebrations ran 15-20 June 2014 as a kalyana mahotsavam, with…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Ammavari Alayam, Karampudi
Karampudi,
Palnadu
Has its own section heading in the Karampudi article, and is independently listed in Telugu Wikipedia's 'List of pilgrimage places of Andhra Pradesh' among Karampudi's temples, alongside the Chennakesava Swamy temple and the Veerl…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswara Swamy Alayam, Alavalapadu
Alavalapadu,
Prakasam
'In this village, under the auspices of the Sri Vasavi Seva Sangham and with donors' contributions, a Sri Vasavi Kanyaka Parameswara Swamy temple and a Gangaanamma temple (kuladevata of the Kanamarlapudi lineage) are being built. …
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Ammavari Alayam, Kunduru (West)
Kunduru (West),
Prakasam
Own section: 'The re-installation of the idols in this newly rebuilt ancient temple at Kunduru was performed grandly on Thursday 17 December 2015 amid the chanting of Vedic pandits, with Rs. 20 lakh of pooled village funds. Afterw…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Ammavari Alayam, Makkena Vari Palem
Makkena Vari Palem,
Prakasam
Own section heading. The article records the temple's first anniversary being celebrated grandly on Friday 22 May 2015 with the temple decorated for the occasion, implying establishment in 2014. Makkena Vari Palem is a non-revenue…
No freely licensed photograph
of this building yet
of this building yet
Vysya Bank branch, Hindupur
Hindupur,
Sri Sathya Sai
Listed in the banking table of the District Census Handbook, Anantapur District (1961 Census). Recorded because the name is an explicit Arya Vysya / Vysya community marker. No individual names recorded. Present-day status NOT veri…
No freely licensed photograph
of this building yet
of this building yet
Kanyaka Parameswari Temple, Vizianagaram
Vizianagaram,
Vizianagaram
The official district site states: 'This temple is situated in Vizianagaram Town and it was built in the year 1890 by the Komatis (Trading community)', on land donated by the Maharaja of Vizianagaram. Komati = Arya Vysya; Kanyaka …
Photo:
Saiphani02 (Wikimedia Commons user)
· CC BY-SA 4.0
Sri Vasavi Kanyakaparameshwari Ammavari Temple, Penugonda
Vasavi Penugonda (Penugonda),
West Godavari
Official West Godavari district government tourism page states verbatim: 'This Penugonda Kshetram is considered as the Kasi of Vysyas and is a holy place' for the community, and records Kusuma Sresti, a Setty king of the Vysyas al…
Photo:
B.K.Viswanadh (Telugu Wikipedia user, own work)
· CC BY 2.5
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Nityannadana Satram, Gandi Kshetram
Gandi,
YSR Kadapa
Telugu Wikipedia's article on the Gandi kshetram - on the Papaghni river where it cuts through the Seshachalam hills - states flatly: 'In Gandi kshetram there is an Arya Vysya nityannadana satram.' Independently corroborated by th…
No freely licensed photograph
of this building yet
of this building yet
Sri Kanyaka Parameswari Ammavari Alayam, Porumamilla
Porumamilla,
YSR Kadapa
Has its own section. Records that Mangala Gauri was installed in this temple, that a village procession was taken from the temple to Malla Kattuva where the Mangala Gauri was immersed, and that 'many Arya Vysya women of the town t…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Temple (Sri Matha Kanyakaparameswari Devi Temple / Ammavarisala)
Proddatur,
YSR Kadapa
Established 1890 in Proddatur. Principal deity of the Arya Vysya (Vaishya) community. Administered by the local Arya Vaishya Sangam / Arya Vysya Sabha. Dasara (Sharannavaratri) festival celebrated annually since 1895.
No freely licensed photograph
of this building yet
of this building yet
Temple of Kanyakamma (Kanyaka Parameswari), Vanipenta
Vanipenta,
YSR Kadapa
The 1915 Cuddapah Gazetteer states: 'In the main street in the centre of the village is a large temple of Kanyakamma erected by the Komati community who specially worship this goddess. It is of modern construction and built of Cud…
No freely licensed photograph
of this building yet
of this building yet
Sri Nageswara - Kanyaka Parameswara Swamy Alayam, Beluguppa
Beluguppa,
Anantapur
Listed in the Shirpi village article's regional temple list as 'Beluguppa - Sri Nageswara, Kanyaka Parameswara Swamy temple'. Nageswara together with Kanyaka Parameswari is the standard Arya Vysya pairing.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Arya Vysya Nityannadana Satra Samudayam, Kasapuram
Kasapuram,
Anantapur
Register entry 'శ్రీ వాసవీ ఆర్యవైశ్య నిత్యాన్నదాన సత్ర సముదాయం, కసాపురం, గుంతకల్లు మండలం, అనంతపూర్ జిల్లా' - a satram complex (samudayam, i.e. more than one building) at the Kasapuram Nettikanti Anjaneya Swamy kshetram. Recorded f…
No freely licensed photograph
of this building yet
of this building yet
Sri Subrahmanyeswara Swamy Arya Vysya Satram, Pampanur
Pampanur,
Anantapur
Register entry 'శ్రీ సుబ్రహ్మణ్యేశ్వర స్వామి ఆర్యవైశ్య సత్రం, పంపనూరు, అనంతపురం జిల్లా'. Recorded from the community-maintained Arya Vysya nitya-anna satram register; the same register also appears, machine-translated into English…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Devasthanam, Rayachoti
Rayachoti,
Annamayya
Described as 'another well-known historic temple of this area': built in 1931 in the local Gandhi Bazaar, and (per the article) very handsomely rebuilt in 2025. Telugu Wikipedia's own footnote for this passage points at an Instagr…
No freely licensed photograph
of this building yet
of this building yet
Kanyakaparameswari Alayam, Santharavuru
Santharavuru,
Bapatla
Listed among the village's temples, with the Venkateswara Swamy padukalu, Veerabhadra Swamy and Poturaju shrines. The article files the village under Prakasam; Chinaganjam mandal is now in Bapatla district.
No freely licensed photograph
of this building yet
of this building yet
Kanyakaparameswari Devalayam, Swarna
Swarna,
Bapatla
Listed among the temples of Swarna, a village the article says was formed in 1154 CE according to the 'Swarna Charitra'. The Kanyakaparameswari temple is named after the ancient Vallabharaya Swamy temple, the Uttarabazar Sivalayam…
No freely licensed photograph
of this building yet
of this building yet
Aragonda Sri Veeranjaneyaswamy Arya Vysya Nityannadana Satram
Aragonda,
Chittoor
Register entry 'అరగొండ శ్రీ వీరాంజనేయస్వామి ఆర్యవైశ్య నిత్యాన్నదాన సత్రం, అరగొండ, చిత్తూరు జిల్లా'. Recorded from the community-maintained Arya Vysya nitya-anna satram register; the same register also appears, machine-translated i…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Nityannadana Satram, Kotipalli
Kotipalli,
Dr. B. R. Ambedkar Konaseema
Register entry 'ఆర్యవైశ్య నిత్యాన్నదాన సత్రం, కోటిపల్లి, తూర్పుగోదావరి జిల్లా' - at the Kotipalli Someswara / Godavari sangam bathing place; now in Konaseema district. Recorded from the community-maintained Arya Vysya nitya-anna s…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Arya Vysya Annadana Sangham, Dwaraka Tirumala
Dwaraka Tirumala,
Eluru
Register entry 'శ్రీ వాసవీ కన్యకా పరమేశ్వరీ ఆర్యవైశ్య అన్నదాన సంఘం, ద్వారకాతిరుమల, పశ్చిమగోదావరి జిల్లా'. Dwaraka Tirumala ('Chinna Tirupati') is now in Eluru district. Recorded from the community-maintained Arya Vysya nitya-anna …
No freely licensed photograph
of this building yet
of this building yet
Kanyakaparameswari Satram, Eluru
Eluru,
Eluru
Named in Telugu Wikipedia's article on satrams under 'some prominent satrams': 'the Kanyakaparameswari satram in Eluru'. The article's framing is that Endowments-Department dharmasatrams were being handed back to hereditary truste…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Nitya Annasatra Samajam, Annavaram
Annavaram,
Kakinada
Register entry 'శ్రీ వాసవీ కన్యకా పరమేశ్వరీ నిత్య అన్నసత్ర సమాజం, అన్నవరం, తూర్పుగోదావరి జిల్లా' - at the Satyanarayana Swamy hill temple; Annavaram is now in Kakinada district. Recorded from the community-maintained Arya Vysya ni…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Panchayatana Kshetram (Sri Nagareswara Swamy temple), Gudlavalleru
Gudlavalleru,
Krishna
Section heading reads 'Sri Nagareswaraswamy temple in the Sri Vasavi Panchayatana Kshetram'. Nagareswara paired with Vasavi is the standard Arya Vysya kula-daivam configuration, so the kshetram is a Vysya foundation. No date given…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Seva Sangham, Mantralayam
Mantralayam,
Kurnool
Listed on the Arya Vysya community register of satrams and community bodies as operating at Mantralayam.
No freely licensed photograph
of this building yet
of this building yet
Sri Valli Subrahmanyeswara Swamy Arya Vysya Annadana Satram, Subbarayuni Kotturu
Subbarayuni Kotturu,
Kurnool
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Subbarayuni Kotturu, Kurnool district.
No freely licensed photograph
of this building yet
of this building yet
Sri Kanyaka Parameswari Annasatram Committee, Vijayawada
Vijayawada,
NTR
Register entry 'శ్రీ కన్యకా పరమేశ్వరీ అన్నసత్రం కమిటి, శివాలయం వీథి, విజయవాడ' - the Kanyaka Parameswari annasatram committee in the Sivalayam street quarter. Street name recorded only as the locality identifier used in the registe…
No freely licensed photograph
of this building yet
of this building yet
Sri Durgamalleswara Vasavi Arya Vysya Nityanna Satram, Vijayawada
Vijayawada,
NTR
Register entry 'శ్రీ దుర్గామల్లేశ్వర వాసవీ ఆర్యవైశ్య నిత్యాన్న సత్రం, పాతబస్తీ, అర్జున వీధి, విజయవాడ' - in the Old Town (patabasti) quarter, serving the Kanaka Durga / Malleswara hill temple. Street name omitted. Recorded from the…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Omkara Kshetra Arya Vysya Anna Satram Sangham, Bandi Atmakur
Bandi Atmakur,
Nandyal
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Bandi Atmakur.
No freely licensed photograph
of this building yet
of this building yet
Mahanandi Kshetra Arya Vysya Nityanna Satra Sangham, Diguva Ahobilam
Diguva Ahobilam (Lower Ahobilam),
Nandyal
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Diguva (lower) Ahobilam.
No freely licensed photograph
of this building yet
of this building yet
Srimath Pedda Ahobila Arya Vysya Anna Satram, Eguva Ahobilam
Eguva Ahobilam (Upper Ahobilam),
Nandyal
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Eguva (upper) Ahobilam.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Choudeswari Arya Vysya Nityannadana Satram, Nandavaram
Nandavaram,
Nandyal
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Nandavaram; named for the presiding goddess Chowdeswari.
No freely licensed photograph
of this building yet
of this building yet
Sri Kanyakaparameswari Devi Alayam, Nandikotkur
Nandikotkur,
Nandyal
Listed among the temples of Nandikotkur municipality.
No freely licensed photograph
of this building yet
of this building yet
Kolanu Bharathi Arya Vysya Nityanna Satram, Kolanubharathi Kshetram, Sivapuram, Kothapalli
Sivapuram / Kolanubharathi,
Nandyal
Listed on the Arya Vysya community register of nitya-annadana satrams at the Kolanubharathi kshetram, Sivapuram, Kothapalli.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Yaganti Umamaheswara Vasavi Seva Sangham, Yaganti
Yaganti,
Nandyal
Listed on the Arya Vysya community register of satrams and community bodies as operating at Yaganti in Banaganapalle mandal; 'Vasavi Seva Sangham' identifies it as an Arya Vysya community service body.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyakaparameswari Devasthanam, Buchireddypalem
Buchireddypalem,
Nellore
Listed among the temples of Buchireddypalem town and mandal headquarters.
No freely licensed photograph
of this building yet
of this building yet
Amara Sriramulu Sreshti Arya Vysya Nityannadana Satram, Penchalakona
Penchalakona,
Nellore
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Penchalakona, Nellore district. The institution is named after its founding endower; 'Sreshti' (Setti / Chetty) is the characteristic Arya Vysya h…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Nityanna Sri Vanaprastha Seva Samithi, Amaravati
Amaravati,
Palnadu
Register entry 'శ్రీ వాసవీ నిత్యాన్న శ్రీ వానప్రస్తా సేవా సమితి, అమరావతి, గుంటూరు జిల్లా' - at the Amaralingeswara pancharama kshetram; Amaravati mandal is now in Palnadu district. Recorded from the community-maintained Arya Vysya…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Temple, Salur
Salur,
Parvathipuram Manyam
Listed in the Telugu Wikipedia register of Vasavi Kanyaka Parameswari temples as 'Salur, Manyam, Parvathipuram district 535591', i.e. explicitly placed in the post-2022 Parvathipuram Manyam district.
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Nityanna Dharmasala (satram), Salur
Salur,
Parvathipuram Manyam
Arya Vysya nitya-annadana satram (free-meal pilgrim inn) listed in the Telugu Wikipedia register of Arya Vysya nityanna satrams. Corroborated by an Arya Vysya sathram directory (https://aryavysyasangam.com/sathrams, low confidence…
No freely licensed photograph
of this building yet
of this building yet
Sri Govardhanagiri Arya Vysya Ramanujakutamu
(town not stated in source),
Prakasam
Register entry 'శ్రీ గోవర్ధనగిరి ఆర్యవైశ్య రామానుజకూటము, ప్రకాశం జిల్లా'. The register gives only the district, not the town - recorded as a district-level lead with the exact name as printed. Recorded from the community-maintaine…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Narayana Swamy Kshetra Arya Vysya Anna Satra Sangham, Kovilampadu
Kovilampadu,
Prakasam
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Kovilampadu, Prakasam district.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Nityannadana Satram, Mogilicherla
Mogilicherla,
Prakasam
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Mogilicherla, Prakasam district.
No freely licensed photograph
of this building yet
of this building yet
Sri Bala Koteswara Swamy Arya Vysya Nityannadana Satram, Nandanamarella, Kanigiri
Nandanamarella,
Prakasam
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Nandanamarella, Kanigiri, Prakasam district.
No freely licensed photograph
of this building yet
of this building yet
Sri Nemaligundla Ranganayakula Swamy Arya Vysya Nityanna Satram, Nemaligundla
Nemaligundla,
Prakasam
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Nemaligundla, Prakasam district.
No freely licensed photograph
of this building yet
of this building yet
Sri Palimera Veeranjaneyaswamy Arya Vysya Annasatram Sangham, Pavuluru
Pavuluru,
Prakasam
Register entry 'శ్రీ పాలిమేర వీరాంజనేయస్వామివారి ఆర్యవైశ్య అన్నసత్రం సంఘం, పావులూరు'. The register places it in the Prakasam group of entries. Recorded from the community-maintained Arya Vysya nitya-anna satram register; the same …
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Arya Vysya Nitya Annadana Samajam, Ramatheertham
Ramatheertham,
Prakasam
Listed on the Arya Vysya community register of nitya-annadana satrams as located at Ramatheertham, Prakasam district. This is the only institution in the four districts that carries the full 'Vasavi Kanyaka Parameswari' name in it…
No freely licensed photograph
of this building yet
of this building yet
Akhila Bharata Arya Vysya Vruddha Ashramam and Nityannadana Satram, Tripurantakam
Tripurantakam,
Prakasam
Listed on the Arya Vysya community register as an all-India Arya Vysya home for the aged combined with a daily food-offering satram at Tripurantakam, Prakasam district.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyakaparameswari Alayam, Sitharampuram
Sitharampuram,
Sri Potti Sriramulu Nellore
Listed among the temples of Sitharampuram, a mandal headquarters near the Bhairavakona shaiva pilgrimage site.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Vaishya Anna Daan Satram, Arasavelli
Arasavalli,
Srikakulam
Arya Vysya nitya-anna satram (free-meal pilgrim inn) serving pilgrims to the Arasavalli Sun temple.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Temple, Palasa
Palasa-Kasibugga,
Srikakulam
Listed in the Telugu Wikipedia register of Vasavi Kanyaka Parameswari temples with the location 'Palasa (Srikakulam district), Andhra Pradesh 532221'. The Palasa town article itself does not mention it, so on-ground confirmation i…
No freely licensed photograph
of this building yet
of this building yet
Srikalahastheeswara Arya Vysya Nitya Annadana Trust
Srikalahasti,
Tirupati
Register entry 'శ్రీకాళహస్తీశ్వర ఆర్యవైశ్య నిత్య అన్నదాన ట్రస్టు, ... శ్రీకాళహస్తి'. A second Arya Vysya annadana body at Srikalahasti, distinct from the Srikalahasti Vasavi Nitya Anna Santarpana Samstha already recorded. Street-l…
No freely licensed photograph
of this building yet
of this building yet
Srinivasa Mangapuram Arya Vysya Annadana Samajam
Srinivasamangapuram,
Tirupati
Register entry 'శ్రీనివాస మంగాపురం ఆర్యవైశ్య అన్నదాన సమాజం, శ్రీనివాసమంగాపురం, చిత్తూరు జిల్లా'. Serves the Kalyana Venkateswara temple town; filed under the pre-2022 Chittoor district, now Tirupati district. Recorded from the com…
No freely licensed photograph
of this building yet
of this building yet
Sri Padmavati Arya Vysya Nityannadana Seva Samajam, Tiruchanur
Tiruchanur (Alivelumangapuram),
Tirupati
Register entry 'శ్రీ పద్మావతి ఆర్యవైశ్య నిత్యాన్నదాన సేవ సమాజం, అలివేలుమంగాపురం, తిరుచానూరు'. Recorded from the community-maintained Arya Vysya nitya-anna satram register; the same register also appears, machine-translated into En…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Padmavati Arya Vysya Annadana Satram, Tiruchanur
Tiruchanur (Alivelumangapuram),
Tirupati
Register entry 'శ్రీ వాసవీ పద్మావతి ఆర్యవైశ్య అన్నదాన సత్రం, సన్నిధి వీధి, అలివేలు మంగాపురం, తిరుచానూరు'. A second Arya Vysya annadana house at the Padmavati temple town. Street name omitted. Recorded from the community-maintained…
No freely licensed photograph
of this building yet
of this building yet
Srivari Sannidhi Sri Kasi Annapurna Arya Vysya Nityannasatram, Tirupati
Tirupati,
Tirupati
Register entry 'శ్రీవారి సన్నిధి, శ్రీ కాశీ అన్నపూర్ణ ఆర్యవైశ్య నిత్యాన్నసత్రం, తిరుపతి'. Recorded from the community-maintained Arya Vysya nitya-anna satram register; the same register also appears, machine-translated into Englis…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Nilayam (Upputuri Yatirajulu Setty Trust), Tirupati
Tirupati,
Tirupati
Register entry 'వాసవీ నిలయం, ఉప్పుటూరి యతిరాజులు శెట్టి ట్రస్ట్, కొత్తవీధి, తిరుపతి'. The founder's name forms part of the trust's own registered name and is therefore retained; no other personal data recorded. Street name omitted…
No freely licensed photograph
of this building yet
of this building yet
Sri Tirumala-Tirupati Balaji All India Arya Vysya Nityannasatram (Attuluri Trust), Tirupati
Tirupati,
Tirupati
Register entry 'శ్రీ తిరుమల-తిరుపతి బాలాజీ ఆల్ ఇండియా ఆర్యవైశ్య నిత్యాన్నసత్రం (అత్తులూరి ట్రస్టు), తిరుపతి'. Trust family name is part of the institution's own name. Distinct from the Tirumala satrams already recorded, which are …
No freely licensed photograph
of this building yet
of this building yet
Sri Kasi Annapurna Vasavi Arya Vysya Vruddhashramam and Nityannadanam, Tirupati
Tirupati,
Tirupati
Register entry 'శ్రీ కాశీ అన్నపూర్ణ వాసవి ఆర్యవైశ్య వృద్ధాశ్రమము మరియు నిత్యాన్నదానం, కొత్తవీధి, తిరుపతి'. A combined old age home and daily-annadanam house. Street name omitted. Recorded from the community-maintained Arya Vysya n…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Temple, One Town / Fort Ward
Visakhapatnam,
Visakhapatnam
Gopura-style temple in the old One Town trading quarter near Kurupam Market, reported as about 135 years old and revered by the Arya Vysya community as their ilavelpu (family deity); favoured by the business community of the north…
No freely licensed photograph
of this building yet
of this building yet
Vysya Students Hostel, Visakhapatnam (The Vysya Students Welfare Association, Vizagpatam)
Visakhapatnam,
Visakhapatnam
Community charitable hostel at Maharanipeta near Jagadamba Junction, established 18 October 1937 to house and fund Arya Vysya students studying in the city; accommodation is free and students run the mess cooperatively. Blocks reb…
No freely licensed photograph
of this building yet
of this building yet
Vysya Students Hostel - Madhurawada branch
Visakhapatnam,
Visakhapatnam
Second hostel block of the same 1937 association, at Midhilapuri VUDA Colony, Madhurawada, on a 600 sq yd site for about 80 Arya Vysya students attending the Madhurawada college cluster; new building inaugurated 18 June 2017.
No freely licensed photograph
of this building yet
of this building yet
Vasavi Clubs International - 'E' Vanitha Greater Visakha club (No. 4282)
Visakhapatnam,
Visakhapatnam
Vasavi Clubs International, the Arya Vysya service-club movement founded at Hyderabad in 1961, lists a Greater Visakha Vanitha club among its chartered clubs.
No freely licensed photograph
of this building yet
of this building yet
Vasavi Clubs International - first Vanitha (women's) club
Vizianagaram,
Vizianagaram
Vasavi Clubs International, the Arya Vysya service-club movement founded at Hyderabad in 1961, states on its own site that its first Vanitha (women's) club was started at Vizianagaram in 2001-02.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Nityannadana Samajam, Penugonda
Vasavi Penugonda (Penugonda),
West Godavari
Community charitable organisation at Penugonda providing nithya annadanam (daily free meals) and pilgrim welfare services; the organisation's own site states it has served since 1972.
No freely licensed photograph
of this building yet
of this building yet
Akhila Bharata Sri Vasavi Penugonda Trust (Vasavi Shantidhamam), Penugonda
Vasavi Penugonda (Penugonda),
West Godavari
Register entry 'అఖిల భారత శ్రీ వాసవీ పెనుగొండ ట్రస్టు, వాసవీ శాంతిధామం, పెనుగొండ, పశ్చిమగోదావరి జిల్లా'. A distinct body from the Arya Vysya Nityannadana Samajam, Penugonda already recorded - the register lists both separately at …
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Veerabrahmendra Arya Vysya Nityannadana Sangham, Brahmamgari Matham
Brahmamgari Matham (Kandimallayapalle),
YSR Kadapa
Register entry 'శ్రీ వాసవీ వీరబ్రహ్మేంద్ర ఆర్యవైశ్య నిత్యాన్నదాన సంఘం, బ్రహ్మంగారి మఠం, కడపజిల్లా' - at the Veerabrahmendra Swamy matham. Recorded from the community-maintained Arya Vysya nitya-anna satram register; the same regis…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Jyoti Narasimha Kasinayaka Arya Vysya Nityannadana Sangham, Kasinayana Kshetram
Kasinayana (Kasinayana Kshetram),
YSR Kadapa
Register entry 'శ్రీ వాసవీ జ్యోతి నరసింహ కాశీనాయక ఆర్యవైశ్య నిత్యాన్నదాన సంఘం, కాశీనాయక క్షేత్రం, కడపజిల్లా'. Recorded from the community-maintained Arya Vysya nitya-anna satram register; the same register also appears, machine-tr…
No freely licensed photograph
of this building yet
of this building yet
Sri Ponatala Mallikarjuna Swamy Arya Vysya Vasavi Kartika Samaradhana Sangham, Ponatala
Ponatala,
YSR Kadapa
Register entry 'శ్రీ పోణతల మల్లికార్జునస్వామి ఆర్యవైశ్య వాసవీ కార్తీక సమారాధన సంఘం, పోణతల, కడపజిల్లా'. Unusual in the register for being explicitly a Kartika-month samaradhana body rather than a year-round satram. Recorded from th…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
The Proddatur Arya Vysya Yuvajana Samakhya (TPAVYS)
Proddatur,
YSR Kadapa
Arya Vysya community youth association based in Proddatur, registered in 2023 (registration no. 209/2023) per its own site; runs medical camps, educational support and community awareness programmes. Recorded as an institution onl…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Devi Alayam, Pulivendula
Pulivendula,
YSR Kadapa
Listed among the temples of Pulivendula town.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Lakshmi Chennakeswara Swamy Arya Vysya Nityannadana Satram, Pushpagiri
Pushpagiri,
YSR Kadapa
Register entry 'శ్రీ వాసవీ లక్ష్మీ చెన్నకేశ్వరస్వామి ఆర్యవైశ్య నిత్యాన్నదాన సత్రం, పుష్పగిరి క్షేత్రం, కడపజిల్లా' - at the Pushpagiri temple complex on the Penna. Recorded from the community-maintained Arya Vysya nitya-anna satram…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Kanyaka Parameswari Alayam, S. Mydukur
S. Mydukur,
YSR Kadapa
Listed among the temples of S. Mydukur, a municipal town and mandal headquarters.
Sri Vasavi Kanyakaparameswari Ammavari Devalayamu, Eepurupalem
Eepurupalem,
Bapatla
Recorded from a freely licensed photograph on Wikimedia Commons. No documentary source beyond the photograph itself.
Photo:
Rampharma83
· CC BY-SA 4.0
No freely licensed photograph
of this building yet
of this building yet
Akhila Bharatha Kanipakam Kshetra Arya Vysya Nithya Anna Poorna Sathram, Kanipakam
Kanipakam,
Chittoor
Arya Vysya free-dining choultry at the Kanipakam temple site, per community satram listings. Uncited listing only; institution name and town recorded, no contact details.
No freely licensed photograph
of this building yet
of this building yet
Vasavi Kanyaka Parameswari Temple, Kaikaluru
Kaikaluru,
Eluru
Recorded from a freely licensed photograph hosted on Telugu Wikipedia. No documentary source beyond the photograph itself.
Photo:
B.K.Viswanadh (Telugu Wikipedia user, own work)
· CC BY 2.5
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Devi Devasthanam, R Agraharam, Guntur
Guntur,
Guntur
Arya Vysya devasthanam on Etukuru Road, R Agraharam. Secondary accounts describe it as over 100 years old with a temple board running annadanam and community welfare, but the temple's own domain (srikanyakaparameshwaritemple.com) …
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Kalyana Mandapam, Pedanandipadu
Pedanandipadu,
Guntur
Community marriage hall carrying the Arya Vysya name. Listed only in a commercial business directory; no official or endowments-department confirmation was found.
Vasavi Mata Temple, Siripuram
Siripuram,
Guntur
Recorded from a public-domain photograph on Wikimedia Commons. No documentary source beyond the photograph itself.
Photo:
Upendra1978
· Public domain (PD India)
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyakaparameswari Vysya Vidhyanidhi, Ithanagar, Tenali
Tenali,
Guntur
Arya Vysya educational endowment - 'vidyanidhi' means education fund. Directory listing only; no registration document located. This is the only education-specific Vysya endowment confirmed anywhere in the belt.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Vari Temple, Suryanarayanapuram, Kakinada
Kakinada,
Kakinada
UNVERIFIED LEAD - DO NOT PUBLISH WITHOUT RE-VERIFICATION. Appears only in a commercial business directory listing, not in any official, census or scholarly source. Recorded as a research lead that a second Vasavi Kanyaka Parameswa…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Kanyaka Parameswari Temple, Kothapet, Vijayawada
Vijayawada,
NTR
Vasavi Kanyaka Parameswari temple in the Kothapet locality, inside Vijayawada's One Town commercial quarter. Evidenced only by a commercial business directory listing. Checked against the Krishna district official endowments page …
No freely licensed photograph
of this building yet
of this building yet
Kanyaka Parameswari Temple, KT Road (Fraserpeta), Vijayawada
Vijayawada,
NTR
Second Kanyaka Parameswari temple in Vijayawada, on KT Road in the Fraserpeta area. Directory listing only.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Temple, Stonehousepet, Nellore
Nellore,
Nellore
A Sri Vasavi Kanyaka Parameswari temple is listed at Stonehousepet, Nellore. Vasavi Kanyaka Parameswari is the kuladevata of the Arya Vysya / Komati community, so such a temple normally marks an established Arya Vysya settlement i…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Temple, Narasaraopet Bazar
Narasaraopet,
Palnadu
Sited inside the town's bazar - the characteristic placement of an Arya Vysya temple at the centre of the merchant quarter. Directory listing only.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameshwari Temple, Penukonda
Penukonda,
Sri Sathya Sai
A Vasavi Kanyaka Parameswari temple on the main road at Penukonda appears in commercial directory and community listings. No government, endowments-department or census source confirming it was located; recorded at low confidence.
No freely licensed photograph
of this building yet
of this building yet
Vasavi Nivasam (Arya Vysya nitya anna satram)
Puttaparthi,
Sri Sathya Sai
Listed in Telugu Wikipedia's register of Arya Vysya perpetual-feeding satrams. TWO CAVEATS: the article carries a 'sources need review' banner, and the PIN printed against Puttaparthi (616134) is wrong - it is 515134. Plausible bu…
Kanyaka Parameswari Temple, Puttur
Puttur,
Tirupati
Recorded from a freely licensed photograph on Wikimedia Commons which carries GPS coordinates for the building. No documentary source beyond the photograph itself.
Photo:
Vadanagiri bhaskar
· CC0
No freely licensed photograph
of this building yet
of this building yet
Srikalahasthi Vasavi Nithya Anna Santharpana Samstha
Srikalahasti,
Tirupati
Arya Vysya free-dining (nithya annadanam) institution at Srikalahasti, named in community satram listings. Uncited listing; recorded as an institution name only, no contact details.
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Satram, Tirumala - Dakshina India Arya Vysya Sri Vasavi Kanyaka Parameswari Dharma Paripalana Samstha
Tirumala,
Tirupati
Community choultry for Arya Vysya pilgrims near the Tirumala temple, per travel-booking listings. Uncited commercial listing; no official confirmation found.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Temple, Jammalamadugu
Jammalamadugu,
YSR Kadapa
Constructed 1903 with the cooperation of the Vysya community of Jammalamadugu and surrounding area; maintained by the Komati (Arya Vysya) community through elected representatives; large Dasara gathering.
Telangana · 81
No freely licensed photograph
of this building yet
of this building yet
The Vasavi Co-operative Urban Bank Ltd., Hyderabad
Hyderabad,
Hyderabad
Co-operative urban bank licensed by the Reserve Bank of India on 13 July 1982. RBI cancelled its licence with effect from close of business 14 July 2014 after the bank ceased to be solvent; it had been classified 'weak' since July…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Devasthanam, Badepally
Badepally,
Mahabubnagar
Telugu Wikipedia gives the temple its own section in the Badepally article and links it from the Jadcherla article as the first entry in Jadcherla's temple list. The section recounts the Vasavi Purana narrative (Kubera's penance f…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Alayam, Bellampalli
Bellampalli,
Mancherial
Dedicated Telugu Wikipedia article. Bhoomi puja for the temple was performed in 1998; after construction was complete the idol-installation (vigraha pratishtapana) festival was held on 21 February 2000. The article states the temp…
No freely licensed photograph
of this building yet
of this building yet
Sri Ramalingeswara Swamy Kshetra Arya Vysya Vasavi Nityanna Satram Sangam, Keesaragutta
Keesaragutta (Keesara),
Medchal-Malkajgiri
Two independent sources. The Arya Vysya satram register lists it by its full registered name as serving the Keesaragutta Ramalingeswara Swamy hill temple (given under the pre-2016 Rangareddy district). Separately, the Telugu Wikip…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Devalayam, Vasavi Nagar, Devarakonda Road, Kalwakurthy
Kalwakurthy,
Nagarkurnool
Has its own Telugu Wikipedia article. Foundation stone laid 1986; the idol was consecrated in 1988 on Vasavi Kanyaka Parameswari Jayanti; the temple has since held its rajatotsavam (silver jubilee) and the article describes it as …
No freely licensed photograph
of this building yet
of this building yet
Sri Satyanarayana Swamy Arya Vysya Nityanna Satram, Gudem Gutta
Gudem Gutta,
Adilabad
Listed in the all-India Arya Vysya nitya-anna satram register (entry given under the pre-2016 Adilabad district). It serves the Gudem Gutta Sri Satyanarayana Swamy hill temple on Ratnadri hill, which Telugu Wikipedia places near G…
No freely licensed photograph
of this building yet
of this building yet
Sri Bhadrachala Kshetra Vasavi Kanyaka Parameswari Arya Vysya Nityannadana Trust
Bhadrachalam,
Bhadradri Kothagudem
Arya Vysya perpetual free-meal (nitya annadana) trust serving pilgrims at the Bhadrachalam kshetram, on Market Road. Listed in three independent community registers: the Telugu register at vaasavi.net ('sri bhadrachala kshetra vas…
No freely licensed photograph
of this building yet
of this building yet
Sri Veerabhadra Swamy Arya Vysya Nitya Annadana Satram, Kothakonda
Kothakonda,
Hanamkonda
Arya Vysya perpetual free-meal satram at the Kothakonda Veerabhadra Swamy kshetram. Telugu register: 'sri veerabhadraswami aryavysya nityannasatram, Kothakonda, Karimnagar district'; English district-wise list entry 34 under 'H) K…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Public School
Himayatnagar,
Hyderabad
School at Himayatnagar, Hyderabad, sponsored by the Vasavi Academy of Education (established 1981). No community affiliation is stated by the sponsoring body.
No freely licensed photograph
of this building yet
of this building yet
Vasavi College of Music & Dance
Himayatnagar,
Hyderabad
College of music and dance at Himayatnagar, Hyderabad, sponsored by the Vasavi Academy of Education.
No freely licensed photograph
of this building yet
of this building yet
Vasavi Clubs International
Hyderabad,
Hyderabad
Largest service organisation of the Arya Vysya community. The first Vasavi Club was started on 1 October 1961 at Hyderabad with eleven members; the body became the All India Association of Vasavi Clubs (1993), the International As…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Academy of Education
Ibrahimbagh,
Hyderabad
Educational trust established 1981, office at Vasavi College of Engineering, Ibrahimbagh, Hyderabad; sponsors six institutions across Telangana and Andhra Pradesh. IMPORTANT: neither the Academy's own site nor the Wikipedia articl…
No freely licensed photograph
of this building yet
of this building yet
Vasavi College of Engineering
Ibrahimbagh,
Hyderabad
Engineering college founded in 1981 by the Vasavi Academy of Education at Ibrahimbagh, Hyderabad; affiliated to Osmania University; granted autonomy by the UGC and Osmania University, extended for ten years from 2021-22 to 2030-31…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Seva Kendram
Khairatabad,
Hyderabad
Arya Vysya community service organisation founded in 1971 with 24 founding members, established to 'promote the welfare of the Arya Vysya Community in particular and the society in general'. Published office address: 6, Telephone …
No freely licensed photograph
of this building yet
of this building yet
Vasavi Kalyana Mandapam, Khairatabad
Khairatabad,
Hyderabad
Community wedding hall run by Vasavi Seva Kendram at its Khairatabad premises, alongside a guest house and shopping complex.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Kanyaka Parmeshwari Devasthana Sangam, Hyderbasti
Secunderabad,
Hyderabad
Kanyaka Parameswari temple and sangam at Hyderbasti, Secunderabad. The Telangana High Court held that the institution is governed by the provisions of the Endowments Act and must strictly adhere to the statutory rules and procedur…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Mata Alayam, Korutla
Korutla,
Jagtial
The Korutla town article states, in its temples section immediately after describing the Markandeya mandiram built in 1925 in the Nizam period and the later Koti Navadurga Shiva Markandeya mandiram on the same site, that 'there is…
No freely licensed photograph
of this building yet
of this building yet
Sri Kodavatur Siddeswara Swamy Arya Vysya Nityannadana Sangam, Kodavatur
Kodavatur (Koduvatur),
Jangaon
Listed in the Arya Vysya satram register under 'Kodavatur, Warangal district' (pre-2016). Telugu Wikipedia has a village article for Kodavatur/Koduvatur in Bachannapet mandal, Jangaon district, about 5 km from the mandal centre; t…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Arya Vysya Nityanna Satra Sangam, Palakurthi
Palakurthi,
Jangaon
Arya Vysya perpetual free-meal society; entry 81 under 'U) WARANGAL DISTRICT' in the district-wise English list, and 'vasavi aryavysya nityannasatra sangam, Palakurthi, Warangal district' in the Telugu register. Palakurthi mandal …
No freely licensed photograph
of this building yet
of this building yet
Sri Mallikarjuna Swamy Kshetra Arya Vysya Sangam, Palakurthi
Palakurthi,
Jangaon
A second Arya Vysya body at Palakurthi attached to the Mallikarjuna Swamy kshetram; entry 82 in the district-wise English list, and given on the aryavysyapdrl list as 'Palakurti - Sri mallikarjuna swami khetra aryavysya vasavi nit…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Arya Vysya Nityanna Satram, Mahadevpur mandal, Kaleshwaram
Kaleshwaram,
Jayashankar Bhupalpally
Arya Vysya perpetual free-meal satram at Kaleshwaram. Telugu register: 'sri vasavi aryavysya nityanna satram, Mahadevpur mandalam, Kaleshwaram'; English district-wise list entry 33 under 'H) KARIMNAGAR DISTRICT'; also on the aryav…
No freely licensed photograph
of this building yet
of this building yet
Sri Kaleshwara Mukteswara Sri Vasavi Annapurna Arya Vysya Nityanna Satram, Kaleshwaram
Kaleshwaram,
Jayashankar Bhupalpally
A second Arya Vysya satram at the same kshetram, named for the presiding deities; entry 32 in the district-wise English list and present in the Telugu register.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Arya Vysya Nityanna Satram (Medi Sankaraiah), Kaleshwaram
Kaleshwaram,
Jayashankar Bhupalpally
A third Arya Vysya satram at Kaleshwaram, identified in both registers by the endowing family name Medi Sankaraiah (Telugu: Medisankarayya); entry 31 in the district-wise English list.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameshwari temple, Kaleshwaram
Kaleshwaram,
Jayashankar Bhupalpally
English Wikipedia's Kaleshwaram article states that in 2018 a Sri Vasavi Kanyaka Parameshwari temple was opened near the Kaleshwara Mukteeshwara Swamy temple, and that adjacent to it was a new Nitya Anna Dhana Vysya Satram; the ar…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Nityanna Satram, Alampur
Alampur,
Jogulamba Gadwal
Listed in the Telugu-language national register of Arya Vysya nitya anna satrams on the Vaasavi community portal as 'Sri Vasavi Nityanna Satram, Alampur, Mahabubnagar district' - the district label predates the 2016 reorganisation…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Arya Vysya Nityannadana Satram and Kalyana Mandapam, Beechupally
Beechupally,
Jogulamba Gadwal
Listed in the Vaasavi register as 'Sri Vasavi Arya Vysya Nityannadana Satramu, Kalyanamandapamu, Beechupally, Mahabubnagar district' - a pre-2016 district label; Beechupally is in Itikyala mandal of Jogulamba Gadwal district. It s…
No freely licensed photograph
of this building yet
of this building yet
Sri Siddhi Rameswara Arya Vysya Nityanna Satram, Bhiknoor
Bhiknoor,
Kamareddy
Listed in the all-India Arya Vysya nitya-anna satram register under 'Bhikkanuru, Nizamabad district' (pre-2016 boundaries; Bhiknoor mandal now falls in Kamareddy district). Attached to the Siddhi Rameswara temple. Published phone …
No freely licensed photograph
of this building yet
of this building yet
Vasavi Kanyaka Parameswari Devalayam, Huzurabad
Huzurabad,
Karimnagar
Listed among the temples of Huzurabad town (a municipality since 2011) in the temples section of the town's Telugu Wikipedia article. No founding date is given. Temple-committee office-bearer names printed beside some other entrie…
No freely licensed photograph
of this building yet
of this building yet
Karimnagar Pattana Arya Vysya Satram (Karimnagar town Arya Vysya satram)
Karimnagar,
Karimnagar
Telugu Wikipedia records that this town satram in Karimnagar was started in 1987, that its founding president served until 2006 and that the remaining committee members continued. Cited in the article to Andhra Prabha (2016) and t…
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Kalyana Mandapam, Madhira
Madhira,
Khammam
The Telugu Wikipedia article on Madhira town states plainly, in its town-amenities paragraph, that 'there is an Arya Vysya Kalyana Mandapam'. A community marriage hall inside a Khammam-district town - the first Arya Vysya institut…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Sri Kanyaka Parameswari Nityanna Satra Sangam, Kuravi
Kuravi,
Mahabubabad
Arya Vysya perpetual free-meal society at the Kuravi kshetram. Telugu register: 'aryavysya sri kanyaka parameswari nityannasatra sangam, Kurvi, Warangal district'; English district-wise list entry 80 under 'U) WARANGAL DISTRICT' a…
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Bhavan, Bellampalli
Bellampalli,
Mancherial
Community hall named as the venue of an 'Oggu Katha - Oggu Dolu Mahotsavam' held on 25 October 2018 under the Telangana government's Language and Culture Department at the Arya Vysya Bhavan in Bellampalli, Mancherial district. Rec…
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Vriddha Sharanalayam (Arya Vysya old-age home) at the Aliabad Ratnalayam
Aliabad,
Medchal-Malkajgiri
The Telugu Wikipedia article on the Aliabad Ratnalayam - a Sridevi-Bhudevi sameta Venkateswara Swamy temple beside the Rajiv Rahadari at the Aliabad road junction in Shamirpet mandal - states that the Arya Vysya old-age home locat…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Devalayam, Vasavi Shiva Nagar, Kushaiguda
Kushaiguda, Hyderabad,
Medchal-Malkajgiri
Listed in the temple roll of the Telugu Wikipedia Kanyaka Parameswari article as 'Vasavi Shiva Nagar, Kushaiguda, Hyderabad, Rangareddy district - 500062' (pre-2016 district naming; Kushaiguda now falls in Medchal-Malkajgiri). The…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameshwari Charitable Trust (Vasavi Temple, Uppal)
Uppal,
Medchal-Malkajgiri
Vasavi Kanyaka Parameshwari temple and charitable trust established by the Uppal Vysya Sangam on land donated by a community family. Published location: Street No. 2, New South Swaroop Colony, near K.K.R Gardens, Venkateshwara Swa…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Devalayam, Peddakarpamula
Peddakarpamula,
Nagarkurnool
Listed in the temple register inside the Telugu Wikipedia article on Kanyaka Parameswari as 'Sri Vasavi Kanyaka Parameswari Devalayam - Peddakarpamula, Peddakothapally mandal, Nagarkurnool district, Telangana - 509412'. An address…
No freely licensed photograph
of this building yet
of this building yet
Sri Sri Vasavi Kanyakaparameswari Arya Vysya Nityannadanam Trust, Cheruvugattu
Cheruvugattu,
Nalgonda
Arya Vysya perpetual free-meal trust. Telugu register: 'sri sri vasavi kanyakaparameswari aryavysya nityannadanam trustu, Cheruvugattu, Market Palli mandalam, Nalgonda district'; the aryavysyasangam.com directory repeats it as 'Ch…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Alayam, Devarakonda
Devarakonda,
Nalgonda
Listed in the 'Devarakonda temples' section of the town's Telugu Wikipedia article, alongside the old Shivalayam, old Ramalayam, Santoshi Mata, Bhakta Markandeya, Sai Baba and Ayyappa temples. Devarakonda became a nagar panchayat …
No freely licensed photograph
of this building yet
of this building yet
Vasavi Kanyaka Parameswari temple, Makhtal
Makthal,
Narayanpet
Listed among the temples of Makhtal in the Telugu Wikipedia section headed 'town of temples', alongside the Shivalayam, Kumbheswaralayam, Venkateswara, Markandeya, Ayyappa, Sathya Sai, Shirdi Sai, Veerabhadreswara and Gopalaswamy …
No freely licensed photograph
of this building yet
of this building yet
Saraswathi Arya Vysya Nityanna Dana Satram, Basar
Basar,
Nirmal
A second, separately listed Arya Vysya satram at the Basar Gnana Saraswathi kshetram, distinct from the Hyasapuri Kanyaka Parameswari Charitable Trust already on record: the two appear as separate consecutive entries in the same r…
No freely licensed photograph
of this building yet
of this building yet
Arya Indur Arya Vysya Gnana Saraswathi Charitable Trust, Basar
Basar,
Nirmal
Named as the Basar entry in the Arya Vysya nitya-anna satram list inside the main Telugu Wikipedia Kanyaka Parameswari article. 'Indur' in the registered name is the old name of Nizamabad, indicating a Nizamabad-rooted trust opera…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Alayamu, Indur (Nizamabad)
Nizamabad (Indur),
Nizamabad
Listed in the temple roll of the main Telugu Wikipedia article on Kanyaka Parameswari as 'Sri Vasavi Kanyaka Parameswari Alayamu, Induru (Nizamabad), Telangana 503001'. Indur is the older name of Nizamabad city, so this is a templ…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Kanyaka Parameswari Alayam, Pegadapalli
Pegadapalli,
Peddapalli
The village article states that Pegadapalli has one Vasavi Kanyaka Parameswari temple and one Venkateswara temple. Pegadapalli is a revenue village of Sriramapur mandal, Peddapalli district.
No freely licensed photograph
of this building yet
of this building yet
Sri Bhakta Veeranjaneya Kshetra Arya Vysya Vasavi Annapurna Nityanna Satram, Agraharam
Agraharam,
Rajanna Sircilla
A third, separately listed satram in Vemulawada mandal, at Agraharam serving the Bhakta Veeranjaneya kshetram, distinct from the two Vemulawada town satrams already on record. Listed under the pre-2016 Karimnagar district. Publish…
No freely licensed photograph
of this building yet
of this building yet
Sri Kanyakaparameswari Devalayam, Amangal
Amangal,
Rangareddy
Described at length in the Telugu Wikipedia article on Amangal (a municipality since 2 August 2018): the temple 'where Sri Kanyakaparameswari - worshipped as Vasavamba, the daughter of the Arya Vysyas who refused marriage to an ar…
No freely licensed photograph
of this building yet
of this building yet
Chilkur Venkateswara Kshetra Arya Vysya Vasavi Nityanna Satram, Chilkur
Chilkur (Chilukuru),
Rangareddy
Listed in the Arya Vysya satram register as serving the Chilkur Balaji (Venkateswara) kshetram. Telugu Wikipedia places Chilkur/Chilukuru in Moinabad mandal, Rangareddy district, on the Hyderabad outskirts. Published phone numbers…
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Kanyaka Parameswari Alayam, Vanasthalipuram
Vanasthalipuram, Hyderabad,
Rangareddy
Listed twice among the principal temples of Vanasthalipuram in the suburb's Telugu Wikipedia article (as item 4 in one list and item 3 in another). The article also carries a photograph captioned 'Sri Kanyakaparameswaralayam under…
No freely licensed photograph
of this building yet
of this building yet
Sri Veerabhadra Swamy Kshetra Arya Vysya Vasavi Nityanna Satram, Bonthapally
Bonthapally,
Sangareddy
Listed in the Arya Vysya satram register under 'Bonthapalli, Rangareddy district' (pre-2016). Telugu Wikipedia places Bonthapally, site of a well-known Veerabhadra Swamy temple about 25 km north of Hyderabad, in Gummadidala mandal…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Nityannadana Satram, Jharasangam
Jharasangam,
Sangareddy
Listed in the Arya Vysya satram register under 'Jharasangam, Medak district' (pre-2016); Jharasangam is now a mandal of Sangareddy district. Published phone number omitted.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Devalayam, Srinivas Nagar Colony, Ramachandrapuram
Ramachandrapuram (BHEL), Hyderabad,
Sangareddy
Listed in the temple roll of the Telugu Wikipedia Kanyaka Parameswari article as 'Srinivas Nagar Colony, Ramachandrapuram, Hyderabad, Medak district - 500032' (pre-2016 district naming; the Ramachandrapuram/BHEL township on the Hy…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Arya Vysya Nityanna Satram, Komuravelli
Komuravelli,
Siddipet
Listed in the Arya Vysya satram register as 'Komarapelli, Warangal district' (pre-2016 naming), and in a community blog's version of the same directory as 'Komaravelli, Cherayala mandal, Warangal dist'. Telugu Wikipedia places Kom…
No freely licensed photograph
of this building yet
of this building yet
Sri Kanyaka Parameswari Arya Vysya Nityanna Satram, Nacharam Gutta (Nachagiri)
Nacharam,
Siddipet
The Vaasavi register lists 'Sri Kanyaka Parameswari Arya Vysya Nityanna Satram, Nacharam Gutta, Medak district'. The gutta (hill) is Nachagiri, site of the Nachagiri Lakshmi Narasimha Swamy temple, which Telugu Wikipedia places at…
No freely licensed photograph
of this building yet
of this building yet
Sri Mattapalli Lakshmi Narasimha Kshetra Arya Vysya Nitya Annadana Satram
Mattapalli,
Suryapet
Arya Vysya perpetual free-meal satram at the Mattapalli kshetram. Telugu register: 'sri mattapalli lakshminarasimha kshetra aryavysya nitya annadana satram, Mattapalli'; English district-wise list entry 60 under 'N) NALGONDA DISTR…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Kanyaka Parameswari temple, Pebbair
Pebbair,
Wanaparthy
Listed among Pebbair's temples on both English and Telugu Wikipedia, with the Shirdi Sai Baba, Hanuman, Brahmamgari, Venugopala Swamy, Ayyappa, Mallishwari Devi, Chowdeshwari Amma and Kodanda Rama temples. A list mention only; no …
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Sangam, Warangal
Warangal,
Warangal
The Telugu Wikipedia biography of a Warangal-born Vysya social reformer and philanthropist (1904-1967) - whose recorded work is entirely Warangal-based: hospital wards and staff quarters at the Nizam-era Sarwar-e-Riyasat hospital …
No freely licensed photograph
of this building yet
of this building yet
Vysya Hostel, Warangal
Warangal,
Warangal
Community student hostel built in Warangal by the same pre-1967 Arya Vysya philanthropist, named in the same sentence of the same biography as the sangam he founded. Founder's name deliberately omitted; the location is inferred fr…
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyaka Parameswari Arya Vysya Nityanna Satra Sangam, Yadagirigutta
Yadagirigutta,
Yadadri Bhuvanagiri
Arya Vysya perpetual free-meal society at the Yadagirigutta kshetram. Corroborated by three independent community registers: the Telugu register at vaasavi.net ('sri vasavi kanyaka parameswari aryavysya nityanna satra sangam, Yada…
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Sangam (aryavysyasangam.com)
Hyderabad,
Hyderabad
Online Arya Vysya community platform for seva, charity, cultural programmes and listings of local sangams and sathrams; the site gives a Hyderabad contact address at Chintal Basthi, Khairatabad. NOTE: the platform also hosts indiv…
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Bhavan, Khairatabad, Hyderabad
Khairatabad, Hyderabad,
Hyderabad
An Arya Vysya community building with lodging rooms at Khairatabad, Hyderabad, named incidentally in an English Wikipedia article about a 2018-20 news event, where it appears only as a location. Recorded because it establishes the…
No freely licensed photograph
of this building yet
of this building yet
Arya Vysya Hostel, Musheerabad (Bakaram), Hyderabad
Musheerabad (Bakaram), Hyderabad,
Hyderabad
An Arya Vysya community hostel building at Musheerabad/Bakaram in Hyderabad, named as the administrative office of the Sri Kasi Annapurna Vasavi Arya Vysya Vruddhashramam and Nityannasatram trust, whose satrams and old-age homes o…
No freely licensed photograph
of this building yet
of this building yet
Sri Lakshmi Narasimha Swamy Kshetra Arya Vysya Vasavi Nitya Anna Satram (also listed as 'Dharmapuri Sri Kanyakaparameshwari Aryavysya Nitya Annadana Satra Sangam')
Dharmapuri,
Jagtial
Arya Vysya nitya-annadana satram (free-feeding pilgrim choultry) attached to the Lakshmi Narasimha Swamy kshetram at Dharmapuri. Listed in three independent Arya Vysya community directories, all of which still place it in the pre-…
No freely licensed photograph
of this building yet
of this building yet
Sri Lakshmi Narasimha Swamy Kshetra Dharmapuri Arya Vaishya Vasavi Nithyanna Satram
Dharmapuri,
Jagtial
Same institution, listed in the Arya Vysya Sangam national sathram directory (machine-translated page).
No freely licensed photograph
of this building yet
of this building yet
Sri Bhakta Anjaneya Swamy Kshetram Arya Vysya Vasavi Nitya Annadana Satram Trust, Muthyampet
Muthyampet (Kondagattu),
Jagtial
Arya Vysya trust running a nitya-annadana satram at the Kondagattu Anjaneya Swamy kshetram. Listed under 'Karimnagar district' in three community directories - the pre-2016 district; Kondagattu is in Jagtial district today.
Sri Vasavi Kanyaka Parameswari Temple, Kaleshwaram
Kaleshwaram,
Jayashankar Bhupalpally
The temple at Kaleshwaram, distinct from the three Arya Vysya satrams already recorded there. Two freely licensed photographs, 2018.
Photo:
Srinivasbabudaram
· CC BY-SA 4.0
No freely licensed photograph
of this building yet
of this building yet
Sri Kalabhairava Swamy Arya Vysya Seva Sangam (nitya-anna satram)
Ramareddy,
Kamareddy
Arya Vysya seva sangam running a daily-feeding satram at the Kalabhairava Swamy shrine. Listed in the community directories under 'Nizamabad district' - the pre-2016 district; Ramareddy is a mandal of Kamareddy district today.
No freely licensed photograph
of this building yet
of this building yet
Tripurantakeswara Veerabhadra Swamy Kshetram Sri Vasavi Arya Vysya Nityanna Satram, Ayyasagaram
Ayyasagaram,
Mahabubnagar
Two independent Arya Vysya sources name this satram. The Telugu Wikipedia satram register gives 'Tripurantakeswara Veerabhadra Swamy kshetra Sri Vasavi Arya Vysya Nityanna Satram, Ayyasagaram, near Amanagallu on the Srisailam-Hyde…
No freely licensed photograph
of this building yet
of this building yet
Vasavi Degree College, Mahabubnagar
Mahabubnagar,
Mahabubnagar
Listed among the degree colleges of Mahabubnagar town on Telugu Wikipedia. CAVEAT: the source states only that a college of this name exists - it does NOT state Arya Vysya management, trusteeship or community affiliation. Recorded…
No freely licensed photograph
of this building yet
of this building yet
Kanyaka Parameswari Temple, Damarcherla
Damarcherla,
Nalgonda
Listed among the temples of Damarcherla mandal on English Wikipedia together with Mutyalamma, Kanaka Durga and Sri Lakshmi Narasimha Swamy temples. The section is flagged as unsourced in the article itself, so confidence is low.
No freely licensed photograph
of this building yet
of this building yet
Arya Vaishya nithyanna satram at Basar (listed as 'Hyasapuri ... Kanyaka Parameshwari Charitable Trust')
Basar,
Nirmal
Arya Vysya pilgrim satram at the Basar kshetram, listed for 'Basara, Adilabad District' (pre-2016 district; Basar is in Nirmal district today). Institution name is garbled by the source site's machine translation.
No freely licensed photograph
of this building yet
of this building yet
No freely licensed photograph
of this building yet
of this building yet
Sri Rajarajeshwari Kshetra Arya Vysya Vasavi Nitya Anna Satra Sangam, Vasavinagar
Vemulawada,
Rajanna Sircilla
Arya Vysya nitya-anna satram at the Raja Rajeshwara Swamy kshetram; the community directories give its locality as Vasavinagar and (in the Arya Vysya Sangam directory) Agraharam, Vemulawada mandal. Listed as 'Sri Kaleshwara Muktes…
No freely licensed photograph
of this building yet
of this building yet
S.R.R.K. Arya Vysya Vasavi Nityanna Satra Sangam, Vemulawada
Vemulawada,
Rajanna Sircilla
Same institution under an abbreviated name in a second community temple directory.
No freely licensed photograph
of this building yet
of this building yet
Sri Vasavi Kanyakaparameshwari Temple, Indus Valley, Bandlaguda Jagir
Bandlaguda Jagir, Hyderabad,
Rangareddy
Listed among the temples of Bandlaguda Jagir municipality on Hyderabad's south-western fringe in the English Wikipedia article, identified by the Indus Valley colony in which it stands. No founding date is given and the temples li…
Sri Vasavi Temple, Batasingaram
Batasingaram,
Rangareddy
Recorded from a freely licensed photograph on Wikimedia Commons, 2022.
Photo:
adbh266
· CC BY-SA 4.0
Sri Kanyaka Parameswari Temple, Vanasthalipuram
Vanasthalipuram,
Rangareddy
Recorded from a public-domain photograph. The photograph shows the building under construction. This is NOT the Uppal temple - a different suburb about 10 km away, and it was nearly mis-attached to Uppal during the image sweep.
Photo:
Bhaskaranaidu
· Public domain (PD-self)
No freely licensed photograph
of this building yet
of this building yet
Vasavi Kanyakaparameswari temple, Warangal (temple not named in the source)
Warangal,
Warangal
The same biography records that the subject 'gave financial help to a Vasavi Kanyakaparameswari temple' in the same breath as founding the Warangal Arya Vysya Sangam and building the Warangal Vysya hostel, implying a Vasavi temple…
No freely licensed photograph
of this building yet
of this building yet
Sri Yadagiri Lakshminarasimha Swamy Vasavi Nityanna Satram, Surendrapuri
Yadagirigutta,
Yadadri Bhuvanagiri
A second Arya Vysya nitya-anna satram recorded in the Telugu register at Surendrapuri, near Yadagirigutta. It appears only in the Telugu register, not in the two English lists, so it is marked low.